PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0016400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family bHLH
Protein Properties Length: 236aa    MW: 25369 Da    PI: 9.6961
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0016400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH474.5e-1560112155
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      r+++hn+ Er RR+++N  ++ Lr+llP++  +++kKls   ++ k+ +Y+ +Lq
  Spipo17G0016400  60 RKQSHNAYERDRRKKMNGLYSSLRSLLPES--EHNKKLSIPNTVSKVLDYVPDLQ 112
                      799**************************6..5******************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.96E-1559128IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.72E-1359116No hitNo description
PROSITE profilePS5088813.97359111IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.0E-1360128IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.4E-1260112IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.6E-965117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGWPPEGSAA VCEVNLGDTF AGGEGFGFYP PAMMAAEPPR AAETTIRSWP TSEESSTMKR  60
KQSHNAYERD RRKKMNGLYS SLRSLLPESE HNKKLSIPNT VSKVLDYVPD LQRQVERLAR  120
RKEEIVARIS REREKDGDSP RIGGGSAAGV TPLVSVADLG GGEMAIQICA SSRGKKGLVS  180
TVLEHLEAEG LAIVSASFLA VNTSRGLLSL HCQVKDATAK VEPGKLRKSL PAVLR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15873KRKQSHNAYERDRRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.18e-35bHLH family protein